(data stored in ACNUC7421 zone)

EMBL: CP001958.PE142

CP001958.PE142       Location/Qualifiers
FT   CDS             complement(135010..136218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_5119 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96635"
FT                   /db_xref="GOA:D6ZA93"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96635.1"
FT                   /translation="MGILKRAARGRPAGRAVVAVAVATLLASGCGSNTPVAPTTTSATK
FT                   IPVHWSPDLPAVIAYQGGVGYGLAQSEPTVRNSIQNVGVSVVHVPVVLDNNGTAIAWSS
FT                   TKISDAKCSIAPESADPNGPKPAPDGTIGSNVYALSDETVLQGIVCDKTDPAYPNQSES
FT                   EASGSKLRKLVDLLKVGTSYNNAVERLWFDVELITDPVQKANTATPEQYVAAVVKAMNE
FT                   ARFDNVIISSYDWRTLPLVHSGFKVGTEQIPGLSTVPTVALVRADTFYPGSPWIGGLNL
FT                   SEVHADLIEAAVKLGVDGIAPDFLASQPLPQPEDQTPPGQQKPLLVSKQFLDRAHKAGL
FT                   KVFPQVINNLNDMDHQLKICQGTDSQLHLDQCVDGIITAYPDVLDTELGTLGANRPAKL
FT                   SPR"
     MGILKRAARG RPAGRAVVAV AVATLLASGC GSNTPVAPTT TSATKIPVHW SPDLPAVIAY        60
     QGGVGYGLAQ SEPTVRNSIQ NVGVSVVHVP VVLDNNGTAI AWSSTKISDA KCSIAPESAD       120
     PNGPKPAPDG TIGSNVYALS DETVLQGIVC DKTDPAYPNQ SESEASGSKL RKLVDLLKVG       180
     TSYNNAVERL WFDVELITDP VQKANTATPE QYVAAVVKAM NEARFDNVII SSYDWRTLPL       240
     VHSGFKVGTE QIPGLSTVPT VALVRADTFY PGSPWIGGLN LSEVHADLIE AAVKLGVDGI       300
     APDFLASQPL PQPEDQTPPG QQKPLLVSKQ FLDRAHKAGL KVFPQVINNL NDMDHQLKIC       360
     QGTDSQLHLD QCVDGIITAY PDVLDTELGT LGANRPAKLS PR                          402
//

If you have problems or comments...

PBIL Back to PBIL home page