(data stored in ACNUC7421 zone)

EMBL: CP001958.PE144

CP001958.PE144       Location/Qualifiers
FT   CDS             137246..137551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0148"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: svi:Svir_03970 SSU ribosomal protein S10P;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96637"
FT                   /db_xref="GOA:D6ZA95"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA95"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADG96637.1"
FT                   /translation="MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTE
FT                   KNVYCVIRSPHKYKDSREHFEMRTHKRMIDILDPTPKTVDALMRINLPASVDVNIQ"
     MAGQKIRIRL KAYDHEAIDA SARKIVETVT RTGASVVGPV PLPTEKNVYC VIRSPHKYKD        60
     SREHFEMRTH KRMIDILDPT PKTVDALMRI NLPASVDVNI Q                           101
//

If you have problems or comments...

PBIL Back to PBIL home page