(data stored in ACNUC7421 zone)

EMBL: CP001958.PE146

CP001958.PE146       Location/Qualifiers
FT   CDS             138224..138880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0150"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: mmi:MMAR_1032
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96639"
FT                   /db_xref="GOA:D6ZA97"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA97"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADG96639.1"
FT                   /translation="MSLTVTIHAADGKSAGTFDLPAEIFDAPANISLLHQVVTAQLAAA
FT                   RQGTHKVKTRGEVSGGGRKPYKQKGTGRARQGSTRAPHFTGGGTVHGPVPRDYSQRTPK
FT                   KMKAAALRGALSDRARGGRVHIVDELVAGQSPSTKKASAFLDSIASRPRLLVVLGRADE
FT                   TGLKSVRNLPHAHILTPDQLNTYDVLKSDDIVFSLEALTTFIEHHKVNKKEEVQA"
     MSLTVTIHAA DGKSAGTFDL PAEIFDAPAN ISLLHQVVTA QLAAARQGTH KVKTRGEVSG        60
     GGRKPYKQKG TGRARQGSTR APHFTGGGTV HGPVPRDYSQ RTPKKMKAAA LRGALSDRAR       120
     GGRVHIVDEL VAGQSPSTKK ASAFLDSIAS RPRLLVVLGR ADETGLKSVR NLPHAHILTP       180
     DQLNTYDVLK SDDIVFSLEA LTTFIEHHKV NKKEEVQA                               218
//

If you have problems or comments...

PBIL Back to PBIL home page