(data stored in ACNUC7421 zone)

EMBL: CP001958.PE147

CP001958.PE147       Location/Qualifiers
FT   CDS             138877..139191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0151"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: rer:RER_18540
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96640"
FT                   /db_xref="GOA:D6ZA98"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA98"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADG96640.1"
FT                   /translation="MTIASIPADPHDVLIRPVVSEKSFALAEQKTYSFVVHPEANKTQV
FT                   KLAVEKVFGVKVARVNIMNRNGKRKRTRFGVGKRADTKRALVSLTESSKTIDIFTTAGA
FT                   "
     MTIASIPADP HDVLIRPVVS EKSFALAEQK TYSFVVHPEA NKTQVKLAVE KVFGVKVARV        60
     NIMNRNGKRK RTRFGVGKRA DTKRALVSLT ESSKTIDIFT TAGA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page