(data stored in ACNUC7421 zone)

EMBL: CP001958.PE15

CP001958.PE15        Location/Qualifiers
FT   CDS             17584..17913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0015"
FT                   /product="thioredoxin"
FT                   /note="KEGG: mjl:Mjls_5779 thioredoxin; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96508"
FT                   /db_xref="GOA:D6Z9I1"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I1"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADG96508.1"
FT                   /translation="MADSESKTLTVTDNSFAQDVLASEQPVLVDFWAAWCGPCRMVAPV
FT                   LEEIAKEQAGKLVVAKLDVDANPKTSTKYDVNSIPNLILFQNGEPVKQIIGAKPKAAIL
FT                   RELGL"
     MADSESKTLT VTDNSFAQDV LASEQPVLVD FWAAWCGPCR MVAPVLEEIA KEQAGKLVVA        60
     KLDVDANPKT STKYDVNSIP NLILFQNGEP VKQIIGAKPK AAILRELGL                   109
//

If you have problems or comments...

PBIL Back to PBIL home page