(data stored in ACNUC7421 zone)

EMBL: CP001958.PE153

CP001958.PE153       Location/Qualifiers
FT   CDS             142092..142442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0157"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: ach:Achl_2679 ribosomal protein L29; TIGRFAM:
FT                   ribosomal protein L29; PFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96646"
FT                   /db_xref="GOA:D6ZAA4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA4"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADG96646.1"
FT                   /translation="MAHRTKAADLRERGRDDLVEQLGKLKEEALHLRFQLATGQLAKNS
FT                   RVSEVKREIAQVYTVIRERELGLSAEPTAEQAKAKKAEKKTDKAEKTDKAEKAEKKESK
FT                   AKKSEKTEGEDA"
     MAHRTKAADL RERGRDDLVE QLGKLKEEAL HLRFQLATGQ LAKNSRVSEV KREIAQVYTV        60
     IRERELGLSA EPTAEQAKAK KAEKKTDKAE KTDKAEKAEK KESKAKKSEK TEGEDA           116
//

If you have problems or comments...

PBIL Back to PBIL home page