(data stored in ACNUC7421 zone)

EMBL: CP001958.PE158

CP001958.PE158       Location/Qualifiers
FT   CDS             145593..146252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02234 lipoprotein LppV"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96651"
FT                   /db_xref="InterPro:IPR032018"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96651.1"
FT                   /translation="MSTDDTMRAGGSSAPRRSWWRRVWKRVLVVLLVLAVCCGGGCVAL
FT                   RKLVDSLDPNPKHMTKEQVAAFEARYLDKGTAEQEARNLEDLLARTGDEIVALVPGLKW
FT                   SWNRDWGRLSCPGDAASDTQVVQIWVRQLVFDGPIPPGVWPQAVAVVRRAAASYGATKY
FT                   QNFIDKPDNRDVNFYSPEGARIGLTSAVLAVLIGVTPCRLPEWYFTERHLPVPAGK"
     MSTDDTMRAG GSSAPRRSWW RRVWKRVLVV LLVLAVCCGG GCVALRKLVD SLDPNPKHMT        60
     KEQVAAFEAR YLDKGTAEQE ARNLEDLLAR TGDEIVALVP GLKWSWNRDW GRLSCPGDAA       120
     SDTQVVQIWV RQLVFDGPIP PGVWPQAVAV VRRAAASYGA TKYQNFIDKP DNRDVNFYSP       180
     EGARIGLTSA VLAVLIGVTP CRLPEWYFTE RHLPVPAGK                              219
//

If you have problems or comments...

PBIL Back to PBIL home page