(data stored in ACNUC7421 zone)

EMBL: CP001958.PE16

CP001958.PE16        Location/Qualifiers
FT   CDS             18132..19340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0016"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="KEGG: msm:MSMEG_6935 N-acetylmuramoyl-L-alanine
FT                   amidase; PFAM: cell wall hydrolase/autolysin;
FT                   Peptidoglycan- binding domain 1 protein; SMART: cell wall
FT                   hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96509"
FT                   /db_xref="GOA:D6Z9I2"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I2"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ADG96509.1"
FT                   /translation="MVFLRRGDIGPEVVAVRAILEELGFLRSSNGSPDQGAAHDGLTPD
FT                   ASGQEARVEALFDAELDLAVRAFQQHRGMLVDGIIGPATSQCLREASFRLGARVTSYQP
FT                   SAPMVGDDVADLQARLHDLGFYMGLVDGYFGPKTHNGLMSYQREFGLTPDGICGPATLR
FT                   SLNFLGSRVTGGSAHELHERELMRLSGPRLEGKRIVIDPGCGADKPGLVVMGAHGPTSE
FT                   ADVLWDLATRLEGRMVATGMEAGFSRSHAHSPTDEERAQTANSYGADIVLALRCATHES
FT                   PMANGVACFYFGNSLGYDSAVGKQLAELIQRELVARTPLRDCRTHGRTWPILRTTRMPS
FT                   VQINIGYLSNPADRAFLSEPSGRDIIAEGILVAVKRLYLLGRGDSPTGSLTFEDLLLHE
FT                   QRA"
     MVFLRRGDIG PEVVAVRAIL EELGFLRSSN GSPDQGAAHD GLTPDASGQE ARVEALFDAE        60
     LDLAVRAFQQ HRGMLVDGII GPATSQCLRE ASFRLGARVT SYQPSAPMVG DDVADLQARL       120
     HDLGFYMGLV DGYFGPKTHN GLMSYQREFG LTPDGICGPA TLRSLNFLGS RVTGGSAHEL       180
     HERELMRLSG PRLEGKRIVI DPGCGADKPG LVVMGAHGPT SEADVLWDLA TRLEGRMVAT       240
     GMEAGFSRSH AHSPTDEERA QTANSYGADI VLALRCATHE SPMANGVACF YFGNSLGYDS       300
     AVGKQLAELI QRELVARTPL RDCRTHGRTW PILRTTRMPS VQINIGYLSN PADRAFLSEP       360
     SGRDIIAEGI LVAVKRLYLL GRGDSPTGSL TFEDLLLHEQ RA                          402
//

If you have problems or comments...

PBIL Back to PBIL home page