(data stored in ACNUC7421 zone)

EMBL: CP001958.PE163

CP001958.PE163       Location/Qualifiers
FT   CDS             150406..151941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0167"
FT                   /product="protein of unknown function DUF43"
FT                   /note="PFAM: protein of unknown function DUF43; KEGG:
FT                   sen:SACE_6413 methyltransferases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96656"
FT                   /db_xref="InterPro:IPR002723"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB4"
FT                   /inference="protein motif:PFAM:PF01861"
FT                   /protein_id="ADG96656.1"
FT                   /translation="MALADIALLLARQTACNRQHLAVLARLLAGGASLQELIDAAALSR
FT                   RGVEAFLRVAGEDVVADADGRQGLRPQAREGYEALLASASRPELRPELLEELRAARARA
FT                   PKPNRNLDHVAATAETVLRRASWIARRFETNGLRVLFVGDHDLTSLAVAKLCPSADIAV
FT                   VDIDEALVEFLAAELSSSGAKFRVRHADLRQRFPADLEAWADLFVADPPYTPDGVALFC
FT                   ARGAQGLRCLAQGRGLVAYGYGEAQPALGLAVQKAIVGLDCLVEELIPDFNRYQGAQAI
FT                   GSASDLHLLRFAPSAAKKVDRIASGGAPAAIYTHGRQSVESSAAAGALDLRKHEPSALF
FT                   RALLWEQGDQLALLVDNNHPDVRSADAQARLREDFAEKWNLRLRKSAPDSVSAIIEADA
FT                   VGGAGPRGLVLARPHGKVKNVLREALVRSAGGRTKNQARELVGSILASLGPWGEGVGEC
FT                   VVGDAPRAMLRTVLHAMENAVSHAMENAVLHAMGDAVSHAMEDAARGARQEGT"
     MALADIALLL ARQTACNRQH LAVLARLLAG GASLQELIDA AALSRRGVEA FLRVAGEDVV        60
     ADADGRQGLR PQAREGYEAL LASASRPELR PELLEELRAA RARAPKPNRN LDHVAATAET       120
     VLRRASWIAR RFETNGLRVL FVGDHDLTSL AVAKLCPSAD IAVVDIDEAL VEFLAAELSS       180
     SGAKFRVRHA DLRQRFPADL EAWADLFVAD PPYTPDGVAL FCARGAQGLR CLAQGRGLVA       240
     YGYGEAQPAL GLAVQKAIVG LDCLVEELIP DFNRYQGAQA IGSASDLHLL RFAPSAAKKV       300
     DRIASGGAPA AIYTHGRQSV ESSAAAGALD LRKHEPSALF RALLWEQGDQ LALLVDNNHP       360
     DVRSADAQAR LREDFAEKWN LRLRKSAPDS VSAIIEADAV GGAGPRGLVL ARPHGKVKNV       420
     LREALVRSAG GRTKNQAREL VGSILASLGP WGEGVGECVV GDAPRAMLRT VLHAMENAVS       480
     HAMENAVLHA MGDAVSHAME DAARGARQEG T                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page