(data stored in ACNUC7421 zone)

EMBL: CP001958.PE164

CP001958.PE164       Location/Qualifiers
FT   CDS             151941..152477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0168"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nfa:nfa45760 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96657"
FT                   /db_xref="GOA:D6ZAB5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG96657.1"
FT                   /translation="MATNTAAPGPRAGIVRRARPEDVPAMRAMVYDLAVYEKAPEQCHL
FT                   TEEQLHASLFGERPAVFAHVAVSPEEESRHDTPGEVVGMAVWFLNYSTWDGVHGIYLED
FT                   LYVRPQSRGSGLGKQLLAALAGECVRNGWSRLSWSVLDWNAPAIGFYQSIGAKAQDEWT
FT                   TYRLCGPELRALAEG"
     MATNTAAPGP RAGIVRRARP EDVPAMRAMV YDLAVYEKAP EQCHLTEEQL HASLFGERPA        60
     VFAHVAVSPE EESRHDTPGE VVGMAVWFLN YSTWDGVHGI YLEDLYVRPQ SRGSGLGKQL       120
     LAALAGECVR NGWSRLSWSV LDWNAPAIGF YQSIGAKAQD EWTTYRLCGP ELRALAEG         178
//

If you have problems or comments...

PBIL Back to PBIL home page