(data stored in ACNUC7421 zone)

EMBL: CP001958.PE171

CP001958.PE171       Location/Qualifiers
FT   CDS             159292..159972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0175"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: dze:Dd1591_3141
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96664"
FT                   /db_xref="GOA:D6ZAC2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC2"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADG96664.1"
FT                   /translation="MAEILDFSELVRARHSVRAFLPEPLSKEELDGVLGDAQRSPSNSN
FT                   TQPWRVHIVSGAKRDELRAALLDAAARGETSLDFSFDPKYGQNEVLLEHMRQFGQVYYE
FT                   TMGVSRDDAEGRSKLMLRNLGFFNAPHVAFLFLPVVGDSVRVAADIGMYAQTFLLSLVA
FT                   RGFGGIPQTMLGHFANTVREVLGISEEHKLLFGISFGRPDESALENSFRVDRTPVEHSV
FT                   VLHS"
     MAEILDFSEL VRARHSVRAF LPEPLSKEEL DGVLGDAQRS PSNSNTQPWR VHIVSGAKRD        60
     ELRAALLDAA ARGETSLDFS FDPKYGQNEV LLEHMRQFGQ VYYETMGVSR DDAEGRSKLM       120
     LRNLGFFNAP HVAFLFLPVV GDSVRVAADI GMYAQTFLLS LVARGFGGIP QTMLGHFANT       180
     VREVLGISEE HKLLFGISFG RPDESALENS FRVDRTPVEH SVVLHS                      226
//

If you have problems or comments...

PBIL Back to PBIL home page