(data stored in ACNUC7421 zone)

EMBL: CP001958.PE175

CP001958.PE175       Location/Qualifiers
FT   CDS             163032..163526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0179"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: mjl:Mjls_2702 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96668"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC6"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADG96668.1"
FT                   /translation="MRRVPAAMIAGLVFLGTAKSFALAEPVNHPVNDEQQSVSTAIARA
FT                   LAQRGMPYVYGGGNAQGPTGNPNGTGVVGFDASGLMVYAFAGAGVKLPRTSTDQYNKAG
FT                   RSVWPQQAQPGDLIFYGPNGTESVAMYLGNGQMLEATNPVVTISPVRSEGMAPYMIRVI
FT                   G"
     MRRVPAAMIA GLVFLGTAKS FALAEPVNHP VNDEQQSVST AIARALAQRG MPYVYGGGNA        60
     QGPTGNPNGT GVVGFDASGL MVYAFAGAGV KLPRTSTDQY NKAGRSVWPQ QAQPGDLIFY       120
     GPNGTESVAM YLGNGQMLEA TNPVVTISPV RSEGMAPYMI RVIG                        164
//

If you have problems or comments...

PBIL Back to PBIL home page