(data stored in ACNUC7421 zone)

EMBL: CP001958.PE179

CP001958.PE179       Location/Qualifiers
FT   CDS             complement(166212..167075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0183"
FT                   /product="Allophanate hydrolase subunit 2"
FT                   /note="KEGG: nfa:nfa56520 hypothetical protein; PFAM:
FT                   Allophanate hydrolase subunit 2; SMART: Allophanate
FT                   hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96672"
FT                   /db_xref="GOA:D6ZAD0"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD0"
FT                   /inference="protein motif:PFAM:PF02626"
FT                   /protein_id="ADG96672.1"
FT                   /translation="MTTERSALVLATGPLALFQDLGRPGLAHLGVPRSGAADRGALATV
FT                   NQLLGNDPAAAAIECLFGGFSLRAEATLELLLAGAPAPGTVDGAPVERLARFELRTGET
FT                   LELGMAPVGARVYIGARGGFEAPRSLGSRSTCTLTGLGPAPIRPGGRIAVAEPAPQAPP
FT                   WDFLSLGPRPGGGPAVLRGRLGPRADRVAGLDLAAQTWVAQEQSDRVGVRLRSSGAGPR
FT                   WRFEPQRSEPVAHGSVQATPSGELICFLADHPTTGGYPVVGVLDEPAVGLVAQLRPGEH
FT                   ARFALS"
     MTTERSALVL ATGPLALFQD LGRPGLAHLG VPRSGAADRG ALATVNQLLG NDPAAAAIEC        60
     LFGGFSLRAE ATLELLLAGA PAPGTVDGAP VERLARFELR TGETLELGMA PVGARVYIGA       120
     RGGFEAPRSL GSRSTCTLTG LGPAPIRPGG RIAVAEPAPQ APPWDFLSLG PRPGGGPAVL       180
     RGRLGPRADR VAGLDLAAQT WVAQEQSDRV GVRLRSSGAG PRWRFEPQRS EPVAHGSVQA       240
     TPSGELICFL ADHPTTGGYP VVGVLDEPAV GLVAQLRPGE HARFALS                     287
//

If you have problems or comments...

PBIL Back to PBIL home page