(data stored in ACNUC7421 zone)

EMBL: CP001958.PE181

CP001958.PE181       Location/Qualifiers
FT   CDS             167809..169137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0185"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="TIGRFAM: citrate synthase I; KEGG: rha:RHA1_ro04998
FT                   type II citrate synthase; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96674"
FT                   /db_xref="GOA:D6ZAD2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD2"
FT                   /inference="protein motif:TFAM:TIGR01798"
FT                   /protein_id="ADG96674.1"
FT                   /translation="MSVAQPAERTDQNAVGAATLRYPGGEKELTVTPAVEGNAGVQLGD
FT                   LLASTGYVTYDEGFMNTASTKSAITYIDGEHGILRYRGYPIDQLAQKSTFLEVSYLLIY
FT                   GELPTAAQLEEFAHKISRHTMLHEDLKRFFDGFPRDAHPMPVLSSAVNALSAYYPDSVD
FT                   PSDPAQVEQSTLRLLAKLPTIAAYAYKKSVGQPFLYPDNSLNLVENFLRMTFGFPAEPY
FT                   DIDPNVVKALDMLFILHADHEQNCSTSTVRLVGSSNANLFTSVSGGINALWGPLHGGAN
FT                   QAVLEMLDQIKASGESASDFLAKVKDKKTRIKLMGFGHRVYRNYDPRAAIVKQTADQIL
FT                   NQLKVTDELLDIAKELEQAALTDEYFVSRKLYPNVDFYTGLIYRAMGFPDRMFTVLFAL
FT                   GRLPGWIAHWREMHDSGPLKIGRPRQIYTGQPERPYVSLTDRV"
     MSVAQPAERT DQNAVGAATL RYPGGEKELT VTPAVEGNAG VQLGDLLAST GYVTYDEGFM        60
     NTASTKSAIT YIDGEHGILR YRGYPIDQLA QKSTFLEVSY LLIYGELPTA AQLEEFAHKI       120
     SRHTMLHEDL KRFFDGFPRD AHPMPVLSSA VNALSAYYPD SVDPSDPAQV EQSTLRLLAK       180
     LPTIAAYAYK KSVGQPFLYP DNSLNLVENF LRMTFGFPAE PYDIDPNVVK ALDMLFILHA       240
     DHEQNCSTST VRLVGSSNAN LFTSVSGGIN ALWGPLHGGA NQAVLEMLDQ IKASGESASD       300
     FLAKVKDKKT RIKLMGFGHR VYRNYDPRAA IVKQTADQIL NQLKVTDELL DIAKELEQAA       360
     LTDEYFVSRK LYPNVDFYTG LIYRAMGFPD RMFTVLFALG RLPGWIAHWR EMHDSGPLKI       420
     GRPRQIYTGQ PERPYVSLTD RV                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page