(data stored in ACNUC7421 zone)

EMBL: CP001958.PE183

CP001958.PE183       Location/Qualifiers
FT   CDS             complement(170043..171212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0187"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: gbr:Gbro_3294
FT                   monooxygenase FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96676"
FT                   /db_xref="GOA:D6ZAD4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD4"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADG96676.1"
FT                   /translation="MVKAVIIGAGMGGTSAALALRHIGFDVEIYEQVRENKPVGAAISV
FT                   WSNGVKCLNHLGLEAQTAKLGGTMNSMSYINGLSGEVMCRFSMLPLIEAVGQRPYPIAR
FT                   AELQLMLMEKFGVDEIQFGKKMTAVADGADAASVRFADGSSASGDIVICADGAKSVGRD
FT                   YVLGRSTQRRYAGYVNFNGLVAVDEAVGPATEWTTYVGEGKRVSVMPVAGNRFYFFFDT
FT                   PEPEGLVFEPGTAKEILAAKFAHWTGGVRALIEAIDPAAVNRVEIFDVDPFDTWVRGRV
FT                   ALLGDAAHNTTPDIGQGGCSAMEDAVALQFAFQDHPNDPHAALLAYQAARTERAGELVL
FT                   RARKRSDVTHAMDPAVTQAWYDKLREEDGSSILRGIADNIMGGPLTPSP"
     MVKAVIIGAG MGGTSAALAL RHIGFDVEIY EQVRENKPVG AAISVWSNGV KCLNHLGLEA        60
     QTAKLGGTMN SMSYINGLSG EVMCRFSMLP LIEAVGQRPY PIARAELQLM LMEKFGVDEI       120
     QFGKKMTAVA DGADAASVRF ADGSSASGDI VICADGAKSV GRDYVLGRST QRRYAGYVNF       180
     NGLVAVDEAV GPATEWTTYV GEGKRVSVMP VAGNRFYFFF DTPEPEGLVF EPGTAKEILA       240
     AKFAHWTGGV RALIEAIDPA AVNRVEIFDV DPFDTWVRGR VALLGDAAHN TTPDIGQGGC       300
     SAMEDAVALQ FAFQDHPNDP HAALLAYQAA RTERAGELVL RARKRSDVTH AMDPAVTQAW       360
     YDKLREEDGS SILRGIADNI MGGPLTPSP                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page