(data stored in ACNUC7421 zone)

EMBL: CP001958.PE184

CP001958.PE184       Location/Qualifiers
FT   CDS             171233..171583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0188"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   msm:MSMEG_6415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96677"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD5"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ADG96677.1"
FT                   /translation="MPVQISAESFERLVGEALDLIPPKLARAVDNVVVLIADRNPEEPD
FT                   LLGLYEGVPLGERGSDYGGSLPDVIHIYRDAILEICDSEDDVVDEVAITVVHEVAHYFG
FT                   VDDEKLHELGWG"
     MPVQISAESF ERLVGEALDL IPPKLARAVD NVVVLIADRN PEEPDLLGLY EGVPLGERGS        60
     DYGGSLPDVI HIYRDAILEI CDSEDDVVDE VAITVVHEVA HYFGVDDEKL HELGWG           116
//

If you have problems or comments...

PBIL Back to PBIL home page