(data stored in ACNUC7421 zone)

EMBL: CP001958.PE189

CP001958.PE189       Location/Qualifiers
FT   CDS             173743..174237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sps:SPs0828 GRAB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96682"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96682.1"
FT                   /translation="MNIARRRPVARAWSAGVLPGVVLALTGACGAAAAVADVRDVCDEG
FT                   QRGVVDVKNSMQSFVEALGEYANATDEGKAERAAVGKFAWLAENSLRVAASRLDSVSSF
FT                   SQPGPITEKSEELVHQMRLLFDALGTNDYAFVDPVIDGYNDAAVGFMAACTGDPVGGDE
FT                   A"
     MNIARRRPVA RAWSAGVLPG VVLALTGACG AAAAVADVRD VCDEGQRGVV DVKNSMQSFV        60
     EALGEYANAT DEGKAERAAV GKFAWLAENS LRVAASRLDS VSSFSQPGPI TEKSEELVHQ       120
     MRLLFDALGT NDYAFVDPVI DGYNDAAVGF MAACTGDPVG GDEA                        164
//

If you have problems or comments...

PBIL Back to PBIL home page