(data stored in ACNUC7421 zone)

EMBL: CP001958.PE19

CP001958.PE19        Location/Qualifiers
FT   CDS             21467..22753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0019"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="KEGG: mmi:MMAR_0768 cyclopropane-fatty-acyl-
FT                   phospholipid synthase UfaA1; PFAM:
FT                   Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96512"
FT                   /db_xref="GOA:D6Z9I5"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I5"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ADG96512.1"
FT                   /translation="MSPNPVLTQPPGLLVDAQRWPDVASVPKGPVAAIGSKVALRLLCQ
FT                   AAERFSVRLARPDGTALGTGRVAAGAPVIVVRQPDRLGRRLARHGLIGFGESYMAGEWD
FT                   SPDLVAALTALAAGMAHLVPRRLQRLRPLVLARQPKAQRNSLSQAQRNIAQHYDLSNEL
FT                   FAAFLDETMVYSSALFEQLPATQDELPEAQRRKVDRLLDLAGVRAGSRVLEIGTGWGEL
FT                   CLRAAQRGATVRSVTLSCEQRELALDRVRRAGFADQVAVDLCDYRSVDGQYDCVVSVEM
FT                   VEAVGREYWPTYFRALDRLVVPGGRVAIQAITMPHDRMLASRRTHTWVQKYIFPGGLLP
FT                   STEAISDVTARHTALRTVERTSLRPHYAQTLQLWRERFLASGDRVAALGFDHVFQRMWE
FT                   LYLAYSEAGFRSGYLDVQQWVFIREGARR"
     MSPNPVLTQP PGLLVDAQRW PDVASVPKGP VAAIGSKVAL RLLCQAAERF SVRLARPDGT        60
     ALGTGRVAAG APVIVVRQPD RLGRRLARHG LIGFGESYMA GEWDSPDLVA ALTALAAGMA       120
     HLVPRRLQRL RPLVLARQPK AQRNSLSQAQ RNIAQHYDLS NELFAAFLDE TMVYSSALFE       180
     QLPATQDELP EAQRRKVDRL LDLAGVRAGS RVLEIGTGWG ELCLRAAQRG ATVRSVTLSC       240
     EQRELALDRV RRAGFADQVA VDLCDYRSVD GQYDCVVSVE MVEAVGREYW PTYFRALDRL       300
     VVPGGRVAIQ AITMPHDRML ASRRTHTWVQ KYIFPGGLLP STEAISDVTA RHTALRTVER       360
     TSLRPHYAQT LQLWRERFLA SGDRVAALGF DHVFQRMWEL YLAYSEAGFR SGYLDVQQWV       420
     FIREGARR                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page