(data stored in ACNUC7421 zone)

EMBL: CP001958.PE192

CP001958.PE192       Location/Qualifiers
FT   CDS             177327..179162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0196"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   msm:MSMEG_0406 acyl-CoA-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96685"
FT                   /db_xref="GOA:D6ZAE3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE3"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADG96685.1"
FT                   /translation="MGHYKANLRDIEFNLFELFGLEETLASGDYGDLDVDAVKDILRET
FT                   RKLAEGPLADTWVGPDRNPPVFDSEKHEIELPKEIAKALDLLYDSGALQVALPEEIGGI
FT                   PAPRALTWALTELLVGSHAAVYFYAIGPAFTAILYALGTDEQKQWSKVIAEQKWGATMV
FT                   LTEPDAGSDVGAGTTKAVEQPDGTWHIEGVKRFITSATSGDYFDNIFHLVLARPEGARA
FT                   GTKGLSLFFVPKWHYDFEKRERGERNGVFVTGVEHKMGIKASATCELTFGQHGKPAVGW
FT                   LVGGVHDGIAQMFDVIENARMLIGIKSIATLSTAYLNALEFAKERVQGSDFTQMLNKDA
FT                   PRVTIMRHPEVRRSLLEQKAYAEGLRALYLLAAAYQDPAVAQRLFGADEDLAYRVNDFL
FT                   LPIVKGFGSEQGYAHLADSLQIFGGSGFLQDYPIEQYIRDAKIDTLYEGTTAIQSLDFF
FT                   FRKIVRDQTAALNHITGQIQEFVDSSAGNGRLKEARELLRAALGDFQATFNALAGIGFA
FT                   AMENPTEGYKIAQSTVRFLMAAGDLLIGWLLQRQAQIAAQALDGGATGADRDFYEGKIA
FT                   SAVFFAKNILPRLASLKSIVENLDNDIMELPEAAF"
     MGHYKANLRD IEFNLFELFG LEETLASGDY GDLDVDAVKD ILRETRKLAE GPLADTWVGP        60
     DRNPPVFDSE KHEIELPKEI AKALDLLYDS GALQVALPEE IGGIPAPRAL TWALTELLVG       120
     SHAAVYFYAI GPAFTAILYA LGTDEQKQWS KVIAEQKWGA TMVLTEPDAG SDVGAGTTKA       180
     VEQPDGTWHI EGVKRFITSA TSGDYFDNIF HLVLARPEGA RAGTKGLSLF FVPKWHYDFE       240
     KRERGERNGV FVTGVEHKMG IKASATCELT FGQHGKPAVG WLVGGVHDGI AQMFDVIENA       300
     RMLIGIKSIA TLSTAYLNAL EFAKERVQGS DFTQMLNKDA PRVTIMRHPE VRRSLLEQKA       360
     YAEGLRALYL LAAAYQDPAV AQRLFGADED LAYRVNDFLL PIVKGFGSEQ GYAHLADSLQ       420
     IFGGSGFLQD YPIEQYIRDA KIDTLYEGTT AIQSLDFFFR KIVRDQTAAL NHITGQIQEF       480
     VDSSAGNGRL KEARELLRAA LGDFQATFNA LAGIGFAAME NPTEGYKIAQ STVRFLMAAG       540
     DLLIGWLLQR QAQIAAQALD GGATGADRDF YEGKIASAVF FAKNILPRLA SLKSIVENLD       600
     NDIMELPEAA F                                                            611
//

If you have problems or comments...

PBIL Back to PBIL home page