(data stored in ACNUC7421 zone)

EMBL: CP001958.PE193

CP001958.PE193       Location/Qualifiers
FT   CDS             179271..180233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0197"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   mav:MAV_0583 periplasmic solute binding protein family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96686"
FT                   /db_xref="GOA:D6ZAE4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE4"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADG96686.1"
FT                   /translation="MMSASPLRRTRYGALALAALALAGCDKSAGGATARTPNIVASTQA
FT                   WALVAKAVAGEQVPVAVIVGAGKDPHEYQFSSRDAAAVESASVAVMGGKGYDSFMDKAL
FT                   PAGGGPKAIKGESATIVSPELRPKGNAALDNPHVFFDFAVVDAVAHELADELSREDSAH
FT                   GDLYRHNLRTLRAQLQGFAEQLEELGRSHPGLRAVQTESVGQYLLDYLGASDVTPAGYR
FT                   AAVANESDPALADQAAAVGLISSRGADLVVDNPQEENKSVNELLAAATSAGVPVVGVGE
FT                   TPPPQVASYSDWLRSILGGFTTALGSPAQPNGEHAGPAR"
     MMSASPLRRT RYGALALAAL ALAGCDKSAG GATARTPNIV ASTQAWALVA KAVAGEQVPV        60
     AVIVGAGKDP HEYQFSSRDA AAVESASVAV MGGKGYDSFM DKALPAGGGP KAIKGESATI       120
     VSPELRPKGN AALDNPHVFF DFAVVDAVAH ELADELSRED SAHGDLYRHN LRTLRAQLQG       180
     FAEQLEELGR SHPGLRAVQT ESVGQYLLDY LGASDVTPAG YRAAVANESD PALADQAAAV       240
     GLISSRGADL VVDNPQEENK SVNELLAAAT SAGVPVVGVG ETPPPQVASY SDWLRSILGG       300
     FTTALGSPAQ PNGEHAGPAR                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page