(data stored in ACNUC7421 zone)

EMBL: CP001958.PE194

CP001958.PE194       Location/Qualifiers
FT   CDS             180214..181008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0198"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: rha:RHA1_ro04478 ABC transporter, ATP-binding
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96687"
FT                   /db_xref="GOA:D6ZAE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG96687.1"
FT                   /translation="MPDRPAEPALRFSAAALRVGERVLVENLDLALAPGEFLAVLGPNG
FT                   AGKSTLVQAALGLRALDAGSVEIFGQPPARARDHIGYLAQRVELDRATALRGRDFVGFG
FT                   YDGFRLGPGFLRAGRRKTAVARTLARLGAEDFADRPVSGLSGGEFARLRLAQALIGDPK
FT                   LLICDEPLVSLDLASQTLVVEQIVRQQQERGAAVVFITHELNPVLAHVDRVLYVARGGH
FT                   RHGPVDEVMTAASLSALYASPIDVLNVRGKLVVVGAGEEGHG"
     MPDRPAEPAL RFSAAALRVG ERVLVENLDL ALAPGEFLAV LGPNGAGKST LVQAALGLRA        60
     LDAGSVEIFG QPPARARDHI GYLAQRVELD RATALRGRDF VGFGYDGFRL GPGFLRAGRR       120
     KTAVARTLAR LGAEDFADRP VSGLSGGEFA RLRLAQALIG DPKLLICDEP LVSLDLASQT       180
     LVVEQIVRQQ QERGAAVVFI THELNPVLAH VDRVLYVARG GHRHGPVDEV MTAASLSALY       240
     ASPIDVLNVR GKLVVVGAGE EGHG                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page