(data stored in ACNUC7421 zone)

EMBL: CP001958.PE195

CP001958.PE195       Location/Qualifiers
FT   CDS             181005..181859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0199"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: nfa:nfa4430 putative ABC
FT                   transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96688"
FT                   /db_xref="GOA:D6ZAE6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE6"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADG96688.1"
FT                   /translation="MSSASFFDWGLTWHLLGYAPTRRAVLAAAILGLLSAALGPFIVQR
FT                   RMSFAVHATSELAVTGAALALFLGGSLRLGSMFGALAAGLVFGLLGLRAADRDIASGVV
FT                   LSFGLGLSVLLLNLREGAATNLSSLLTGGLASVSNDDLRLMAATAVVACLVVMCCGRPL
FT                   WFASLDPFGAAAKGVPTRSLAVGFTVLVAAAAAIGMQVVGALLVLALMVAPAAAAARLT
FT                   ASPRLGAVLAFVFAQLAAVGGVLLSLAPSWPPSALITTICFLLYMGARAVGFFRRRRFR
FT                   AAG"
     MSSASFFDWG LTWHLLGYAP TRRAVLAAAI LGLLSAALGP FIVQRRMSFA VHATSELAVT        60
     GAALALFLGG SLRLGSMFGA LAAGLVFGLL GLRAADRDIA SGVVLSFGLG LSVLLLNLRE       120
     GAATNLSSLL TGGLASVSND DLRLMAATAV VACLVVMCCG RPLWFASLDP FGAAAKGVPT       180
     RSLAVGFTVL VAAAAAIGMQ VVGALLVLAL MVAPAAAAAR LTASPRLGAV LAFVFAQLAA       240
     VGGVLLSLAP SWPPSALITT ICFLLYMGAR AVGFFRRRRF RAAG                        284
//

If you have problems or comments...

PBIL Back to PBIL home page