(data stored in ACNUC7421 zone)

EMBL: CP001958.PE2

CP001958.PE2         Location/Qualifiers
FT   CDS             2095..3288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: mab:MAB_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96495"
FT                   /db_xref="GOA:D6Z9G8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9G8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADG96495.1"
FT                   /translation="MSEEDFTFEVPRDLFADSVSWVTRRLPARPAMPLLAGLLLSADET
FT                   GELSLGGTDYDLTAQAHLSAQVSGPGKVLVSGRLLADIAKALPSPSVRIATEGTKVHVR
FT                   SGSAKFTLPSMPVDEFPSLAEHPTPIGSAQAKELFAAISQVGVAASRDDTLPALTGLRL
FT                   VFTQEGIELAATDRFRLSVRKLVWDGKGVGEEPLTALVPAAVLSEFARTQLETDDAPVE
FT                   FALDQGAGSPSLLGVQAGPFRITTRLLDAQLPDVSQLIPKRYSSLARVELAPLVEAVRR
FT                   VSLVSARRSQIRLDFQGSGSDALLKLSAGAEEAGFAEEELAVQHWGEPISVVFNPGYLL
FT                   DGLSTFRGECGQFGFTGPNRAVALVTGDGPEPEETAEGYTADAPDQVYVLMPVRLQG"
     MSEEDFTFEV PRDLFADSVS WVTRRLPARP AMPLLAGLLL SADETGELSL GGTDYDLTAQ        60
     AHLSAQVSGP GKVLVSGRLL ADIAKALPSP SVRIATEGTK VHVRSGSAKF TLPSMPVDEF       120
     PSLAEHPTPI GSAQAKELFA AISQVGVAAS RDDTLPALTG LRLVFTQEGI ELAATDRFRL       180
     SVRKLVWDGK GVGEEPLTAL VPAAVLSEFA RTQLETDDAP VEFALDQGAG SPSLLGVQAG       240
     PFRITTRLLD AQLPDVSQLI PKRYSSLARV ELAPLVEAVR RVSLVSARRS QIRLDFQGSG       300
     SDALLKLSAG AEEAGFAEEE LAVQHWGEPI SVVFNPGYLL DGLSTFRGEC GQFGFTGPNR       360
     AVALVTGDGP EPEETAEGYT ADAPDQVYVL MPVRLQG                                397
//

If you have problems or comments...

PBIL Back to PBIL home page