(data stored in ACNUC7421 zone)

EMBL: CP001958.PE200

CP001958.PE200       Location/Qualifiers
FT   CDS             184656..185444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0204"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: mmi:MMAR_5379 acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96693"
FT                   /db_xref="GOA:D6ZAF1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF1"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADG96693.1"
FT                   /translation="MEILYGTVNTAARLMWLYQGLRLKIVGVGNMPARGGAVVALNHTG
FT                   YLDIPFGGLTSFLHKRNMRFMYKTEMRENPFVRWLFDRLRHIPVDRDYGKASYDHAVRL
FT                   LKEGELVAVYPETTISRSFELREFKSGAARMAIDAKVPIVPVIVWGSQRIMTKGHPKAM
FT                   GRTKTPIWIEVGEPIAPDLPPEQLIVKLKESMQAKLYEVQDKYAQTFGPYPPGAWWVPK
FT                   RLGGGAPSLEEADALDAAEAEEKRAKRAAARAAGADEKKH"
     MEILYGTVNT AARLMWLYQG LRLKIVGVGN MPARGGAVVA LNHTGYLDIP FGGLTSFLHK        60
     RNMRFMYKTE MRENPFVRWL FDRLRHIPVD RDYGKASYDH AVRLLKEGEL VAVYPETTIS       120
     RSFELREFKS GAARMAIDAK VPIVPVIVWG SQRIMTKGHP KAMGRTKTPI WIEVGEPIAP       180
     DLPPEQLIVK LKESMQAKLY EVQDKYAQTF GPYPPGAWWV PKRLGGGAPS LEEADALDAA       240
     EAEEKRAKRA AARAAGADEK KH                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page