(data stored in ACNUC7421 zone)

EMBL: CP001958.PE202

CP001958.PE202       Location/Qualifiers
FT   CDS             complement(186562..186816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0206"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: rop:ROP_64060
FT                   WhiB family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96695"
FT                   /db_xref="GOA:D6ZAF3"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF3"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ADG96695.1"
FT                   /translation="MDWRHQAVCRDEDPELFFPVGNSGPALEQIKRAKVVCHRCPVSPE
FT                   CLSWALASGQDSGIWGGLSEDERRALKRRNARARARTVV"
     MDWRHQAVCR DEDPELFFPV GNSGPALEQI KRAKVVCHRC PVSPECLSWA LASGQDSGIW        60
     GGLSEDERRA LKRRNARARA RTVV                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page