(data stored in ACNUC7421 zone)

EMBL: CP001958.PE203

CP001958.PE203       Location/Qualifiers
FT   CDS             complement(187157..188137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0207"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="KEGG: rop:ROP_64070 hypothetical protein; PFAM:
FT                   diacylglycerol kinase catalytic region; SMART:
FT                   diacylglycerol kinase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96696"
FT                   /db_xref="GOA:D6ZAF4"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF4"
FT                   /inference="protein motif:PFAM:PF00781"
FT                   /protein_id="ADG96696.1"
FT                   /translation="MRVRAVLVVNPRATTTTAQSRGLLVSLLQNDLDLTVQETSHRGHA
FT                   AELAAECVANGTDLVIAHGGDGTVNELASGLLGPPEQSSRPEPGAAPAVAVIPGGSANV
FT                   FARSLGISPDPRRAVDQLLRALRGNERRRVSAGLCDMSLADGRRESRWFLCNAGLGIDA
FT                   DVVAMMEAGRWSGRPVTPARYFLAAVSAYFRWAFRPGPLTLELPGTAPTRGVGLAFVSN
FT                   CSPWTYFGNRPITTNPGVRHDKGLGVFAATKLDPWHSIPLAVQLLSPRTAPDTPGSVRV
FT                   DNLIELTLSSADALRCQIDGEYVGKRVRAEFRSIPAALDVVAPCS"
     MRVRAVLVVN PRATTTTAQS RGLLVSLLQN DLDLTVQETS HRGHAAELAA ECVANGTDLV        60
     IAHGGDGTVN ELASGLLGPP EQSSRPEPGA APAVAVIPGG SANVFARSLG ISPDPRRAVD       120
     QLLRALRGNE RRRVSAGLCD MSLADGRRES RWFLCNAGLG IDADVVAMME AGRWSGRPVT       180
     PARYFLAAVS AYFRWAFRPG PLTLELPGTA PTRGVGLAFV SNCSPWTYFG NRPITTNPGV       240
     RHDKGLGVFA ATKLDPWHSI PLAVQLLSPR TAPDTPGSVR VDNLIELTLS SADALRCQID       300
     GEYVGKRVRA EFRSIPAALD VVAPCS                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page