(data stored in ACNUC7421 zone)

EMBL: CP001958.PE207

CP001958.PE207       Location/Qualifiers
FT   CDS             complement(190608..192095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0211"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: rop:ROP_64170 putative ATP-dependent RNA
FT                   helicase; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96700"
FT                   /db_xref="GOA:D6ZAF8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF8"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADG96700.1"
FT                   /translation="MITTDIGPSFAELGVHPEIVASLAAAGKHNAFAIQEQALPLALGG
FT                   HDLIGQARTGMGKTLAFGIPLLQRVAEAAAEDIPRALVVVPTRELCLQVTNDLVDACKQ
FT                   LKLSDGRPTRIVSLYGGRPYEGQIATLEKGVDVVVGTPGRLLDLWGRGNLKLNAIRMLV
FT                   LDEADEMLDLGFLPDVEKIMAKLPTGKQTMLFSATIPGPVLTLARTFMTQPTHIRAESH
FT                   DTAAVHERTTQHVYRAHALNKDELVSRFLQAEGRGTTMIFTRTKRSAGKLADELVERGF
FT                   SAGSLHGDMSQGAREEALSGFRKGKIEILVCTDVAARGIDIDGITHVINYTCPEDEKVY
FT                   VHRIGRTGRAGRTGIAITLVDWEDLPRWEHINTALGLNHAEPPETYSNSPHIYTDLGIP
FT                   EGSTGRLTPAQPAPPRAERRERGERPGRRGDSPKPVRDRQRVRRNSATGAAPASGAPAT
FT                   AAAEVGAAPSGAGDADGGAKRPRRRRRRGGAAQPAAE"
     MITTDIGPSF AELGVHPEIV ASLAAAGKHN AFAIQEQALP LALGGHDLIG QARTGMGKTL        60
     AFGIPLLQRV AEAAAEDIPR ALVVVPTREL CLQVTNDLVD ACKQLKLSDG RPTRIVSLYG       120
     GRPYEGQIAT LEKGVDVVVG TPGRLLDLWG RGNLKLNAIR MLVLDEADEM LDLGFLPDVE       180
     KIMAKLPTGK QTMLFSATIP GPVLTLARTF MTQPTHIRAE SHDTAAVHER TTQHVYRAHA       240
     LNKDELVSRF LQAEGRGTTM IFTRTKRSAG KLADELVERG FSAGSLHGDM SQGAREEALS       300
     GFRKGKIEIL VCTDVAARGI DIDGITHVIN YTCPEDEKVY VHRIGRTGRA GRTGIAITLV       360
     DWEDLPRWEH INTALGLNHA EPPETYSNSP HIYTDLGIPE GSTGRLTPAQ PAPPRAERRE       420
     RGERPGRRGD SPKPVRDRQR VRRNSATGAA PASGAPATAA AEVGAAPSGA GDADGGAKRP       480
     RRRRRRGGAA QPAAE                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page