(data stored in ACNUC7421 zone)

EMBL: CP001958.PE208

CP001958.PE208       Location/Qualifiers
FT   CDS             192190..192873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_64180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96701"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF9"
FT                   /inference="similar to AA sequence:KEGG:ROP_64180"
FT                   /protein_id="ADG96701.1"
FT                   /translation="MAVGTLSPVDQTPPAQWHGVPEFLALLAYGELAAYYRLAEDAALA
FT                   PTLAGKAAIARMGAAQFQHFETLREALAARGADVFQEMTSFQPVLDMFHIRTTPSTWLE
FT                   ALVKFYVGEGLAADFYLEIADGLPPEVAAVVKDVLTDRAHAQFVVEPVRQSVLASPKER
FT                   SRLALWARRLLGEAIAQAQTVLASREELADLLLRSSGNLNRIAQLFDEVTERHQERIRL
FT                   LGLED"
     MAVGTLSPVD QTPPAQWHGV PEFLALLAYG ELAAYYRLAE DAALAPTLAG KAAIARMGAA        60
     QFQHFETLRE ALAARGADVF QEMTSFQPVL DMFHIRTTPS TWLEALVKFY VGEGLAADFY       120
     LEIADGLPPE VAAVVKDVLT DRAHAQFVVE PVRQSVLASP KERSRLALWA RRLLGEAIAQ       180
     AQTVLASREE LADLLLRSSG NLNRIAQLFD EVTERHQERI RLLGLED                     227
//

If you have problems or comments...

PBIL Back to PBIL home page