(data stored in ACNUC7421 zone)

EMBL: CP001958.PE209

CP001958.PE209       Location/Qualifiers
FT   CDS             complement(192896..193801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0213"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mab:MAB_3947 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96702"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG96702.1"
FT                   /translation="MSNIAVRNHPSRVLAKVDDAANRFVLRAAPDWKLSRARRDPSYGT
FT                   AIRGKRVLITGASSGIGEAAAHRFAELGATVLLVARRHDELAAVAAKIHAAGGHAAVFA
FT                   CDLRDLDAVDALAEKVNAEHGGVDVLVNNAGHSIRRDTAESLERWHDIERTMQINYFSA
FT                   MRLVRDFLPGMLERRDGHIINISSWVVPIEAGTRFVGYGAAKAAASIAARSIQLEYGHR
FT                   GVCGSSVHFPLVRTPMIAPTEEYDNLAALSAQEAAEWLVLAARTRVSRVLPRVSYFLQA
FT                   VEVLAPRLARQMIVAGGRGR"
     MSNIAVRNHP SRVLAKVDDA ANRFVLRAAP DWKLSRARRD PSYGTAIRGK RVLITGASSG        60
     IGEAAAHRFA ELGATVLLVA RRHDELAAVA AKIHAAGGHA AVFACDLRDL DAVDALAEKV       120
     NAEHGGVDVL VNNAGHSIRR DTAESLERWH DIERTMQINY FSAMRLVRDF LPGMLERRDG       180
     HIINISSWVV PIEAGTRFVG YGAAKAAASI AARSIQLEYG HRGVCGSSVH FPLVRTPMIA       240
     PTEEYDNLAA LSAQEAAEWL VLAARTRVSR VLPRVSYFLQ AVEVLAPRLA RQMIVAGGRG       300
     R                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page