(data stored in ACNUC7421 zone)

EMBL: CP001958.PE210

CP001958.PE210       Location/Qualifiers
FT   CDS             complement(193828..194730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0214"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mab:MAB_3947 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96703"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG96703.1"
FT                   /translation="MSNNVVTGRRAAKFLSLARDGFTHWGNQHATTARIRKAAKDPSYG
FT                   TAVRNKRVLVTGSSSGIGEQAARQLGSLGAEVILVARRAEELESVAKQIRTAGGRAEAI
FT                   PCDLRELDAVDALCAEVVSKYGGVDVLVNNAGHSIRRSLPEQLARWHDIERVMQINYFS
FT                   AMRLVRGFLPGMLERRDGHIINVASGGVLSEGVPKFAGYIAAKSALSTMSRNINMELRP
FT                   NGVSATTLYYPLVRTPMIAPTEEYAEVPGLSAAQAAEWVVLAARVRPSRIAPRMFRLSP
FT                   VFTAVLPELSEKVIGTQAR"
     MSNNVVTGRR AAKFLSLARD GFTHWGNQHA TTARIRKAAK DPSYGTAVRN KRVLVTGSSS        60
     GIGEQAARQL GSLGAEVILV ARRAEELESV AKQIRTAGGR AEAIPCDLRE LDAVDALCAE       120
     VVSKYGGVDV LVNNAGHSIR RSLPEQLARW HDIERVMQIN YFSAMRLVRG FLPGMLERRD       180
     GHIINVASGG VLSEGVPKFA GYIAAKSALS TMSRNINMEL RPNGVSATTL YYPLVRTPMI       240
     APTEEYAEVP GLSAAQAAEW VVLAARVRPS RIAPRMFRLS PVFTAVLPEL SEKVIGTQAR       300
//

If you have problems or comments...

PBIL Back to PBIL home page