(data stored in ACNUC7421 zone)

EMBL: CP001958.PE216

CP001958.PE216       Location/Qualifiers
FT   CDS             198806..199753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0220"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mab:MAB_3880
FT                   lipase/esterase LipG"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96709"
FT                   /db_xref="GOA:D6ZAG7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG7"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG96709.1"
FT                   /translation="MTSDASQAVPRRSGFAANPQARPGPVTLCYEEFGSDADPAVLLIM
FT                   GWSAQMLYWPTAFCEQLAAKGFRVIRFDNRDIGESTKFRGKKPRPIVPSIVRFFFGKPS
FT                   AGATYALPDLAQDAIALLDALGVAQAHIVGASMGGMIGQIVAADYPDRVLSFGAVFTAP
FT                   LRPFVFFTTLKALPLFLKKPPANETKEQTVDRLSREIQWLSGDAKRHESALRAELARAY
FT                   DRGRGDLAGSVRQMDGLLATASLVGHAERINCPTVVIHGAKDPLVRTACGKDLASIVPG
FT                   ATLRVIPGMGHSIAEPVWPILVDELTANFAKATT"
     MTSDASQAVP RRSGFAANPQ ARPGPVTLCY EEFGSDADPA VLLIMGWSAQ MLYWPTAFCE        60
     QLAAKGFRVI RFDNRDIGES TKFRGKKPRP IVPSIVRFFF GKPSAGATYA LPDLAQDAIA       120
     LLDALGVAQA HIVGASMGGM IGQIVAADYP DRVLSFGAVF TAPLRPFVFF TTLKALPLFL       180
     KKPPANETKE QTVDRLSREI QWLSGDAKRH ESALRAELAR AYDRGRGDLA GSVRQMDGLL       240
     ATASLVGHAE RINCPTVVIH GAKDPLVRTA CGKDLASIVP GATLRVIPGM GHSIAEPVWP       300
     ILVDELTANF AKATT                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page