(data stored in ACNUC7421 zone)

EMBL: CP001958.PE217

CP001958.PE217       Location/Qualifiers
FT   CDS             complement(200458..202269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0223"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK23886 gene product from transcript GK23886-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96710"
FT                   /db_xref="GOA:D6ZAG8"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96710.1"
FT                   /translation="MTSPGWIDKGEEILTGVRDDQWGCDAFDLLDKYIASRTNHMSGIN
FT                   ALGVTWDHGKYDLPAGEYKKQYELEKDIDLGMIRADANRILQAGKDQEALEELRTKAME
FT                   NLKEHWNDSVTEAAHADFDANKKVVITNTDAAKENAKGILQVADSIQQLLKDKHDKTNQ
FT                   ALQSLADSLKQNDADFEKKCESAAKNTQGGYDAESAEWMVTDQSNDKKSKVLTDLLNNR
FT                   SEVRESVYTKIKGSDDAEKDHTRKIYWDGGPPTTYRFDVEWNPDRYLTGEELVRLKQVA
FT                   TRKLNEAGNSRKYYVEAGGVSEYQIWERKDVVTDMNNVMGQINDTCQQLLQLNYNTKNH
FT                   ISEQYHTMAGYLDNINTAPPQTPSTGNTGGGGTGGGGAGGGGSAASGSGSDSGMPPDGS
FT                   PIGSELSSVGGGTGSGGGSALGSAGQALGSAGQALGQAVSGLGSALGGALSGLMGSLGQ
FT                   IIQTAAQAAQQAQQQQAEQEKDRHEKDKGRDDEDEDKNAEKNTDDNKGDNDGKDKQDEA
FT                   KPDQPGASLSQAPNTPHHPAAPAAHTTTDPGPATATAPAGMGHAPATAHNDSGVHKQGD
FT                   NNHGDFEVQATVHQVGAGNQGHITGFE"
     MTSPGWIDKG EEILTGVRDD QWGCDAFDLL DKYIASRTNH MSGINALGVT WDHGKYDLPA        60
     GEYKKQYELE KDIDLGMIRA DANRILQAGK DQEALEELRT KAMENLKEHW NDSVTEAAHA       120
     DFDANKKVVI TNTDAAKENA KGILQVADSI QQLLKDKHDK TNQALQSLAD SLKQNDADFE       180
     KKCESAAKNT QGGYDAESAE WMVTDQSNDK KSKVLTDLLN NRSEVRESVY TKIKGSDDAE       240
     KDHTRKIYWD GGPPTTYRFD VEWNPDRYLT GEELVRLKQV ATRKLNEAGN SRKYYVEAGG       300
     VSEYQIWERK DVVTDMNNVM GQINDTCQQL LQLNYNTKNH ISEQYHTMAG YLDNINTAPP       360
     QTPSTGNTGG GGTGGGGAGG GGSAASGSGS DSGMPPDGSP IGSELSSVGG GTGSGGGSAL       420
     GSAGQALGSA GQALGQAVSG LGSALGGALS GLMGSLGQII QTAAQAAQQA QQQQAEQEKD       480
     RHEKDKGRDD EDEDKNAEKN TDDNKGDNDG KDKQDEAKPD QPGASLSQAP NTPHHPAAPA       540
     AHTTTDPGPA TATAPAGMGH APATAHNDSG VHKQGDNNHG DFEVQATVHQ VGAGNQGHIT       600
     GFE                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page