(data stored in ACNUC7421 zone)

EMBL: CP001958.PE218

CP001958.PE218       Location/Qualifiers
FT   CDS             complement(202324..202620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lxx:Lxx05400 preprotein translocase subunit
FT                   SecA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96711"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96711.1"
FT                   /translation="MADMANPDGVRSSGQDFHGFAEKAKTIAEQLKGLQMAKGMGAAFS
FT                   AEAEAMQRGLDKVPVPFQHHGEYNNVFGTVLAEAAASYQGTDESNERDLKIDL"
     MADMANPDGV RSSGQDFHGF AEKAKTIAEQ LKGLQMAKGM GAAFSAEAEA MQRGLDKVPV        60
     PFQHHGEYNN VFGTVLAEAA ASYQGTDESN ERDLKIDL                                98
//

If you have problems or comments...

PBIL Back to PBIL home page