(data stored in ACNUC7421 zone)

EMBL: CP001958.PE219

CP001958.PE219       Location/Qualifiers
FT   CDS             202783..203211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96712"
FT                   /db_xref="InterPro:IPR009550"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96712.1"
FT                   /translation="MQPADVLYNMAQSALKRNEQTFQAFQKSMAQRKAQQEALYAQVKE
FT                   KNTAEPTAEELKAEKGERKAASIWNDTGKFGNLESEESVSEEPVKRDVRADADTRSFRP
FT                   VDEDEEAEDAPVGRHSRPDDGIWGASTRKIGSYQDEEE"
     MQPADVLYNM AQSALKRNEQ TFQAFQKSMA QRKAQQEALY AQVKEKNTAE PTAEELKAEK        60
     GERKAASIWN DTGKFGNLES EESVSEEPVK RDVRADADTR SFRPVDEDEE AEDAPVGRHS       120
     RPDDGIWGAS TRKIGSYQDE EE                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page