(data stored in ACNUC7421 zone)

EMBL: CP001958.PE222

CP001958.PE222       Location/Qualifiers
FT   CDS             complement(204815..205846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96715"
FT                   /db_xref="GOA:D6ZAH3"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH3"
FT                   /inference="similar to AA sequence:KEGG:MAB_0657"
FT                   /protein_id="ADG96715.1"
FT                   /translation="MSAALVAAAAAIVLALRVYTLYCLLVRKSGGRLTAVLLRWGALTL
FT                   AILCVFVAALRPSTSQRRQEPLTSPPVAAPSDNPERNIFLLVDRSPNSWADDFGPKHDY
FT                   RMAGVRADLKAIVRQFPHANFSVIAFSATARVDWPLSADTWGLEAFLENYSAYPVTAGA
FT                   LDRADPTAASPLLNQGLDTARQQHPRSQNLVFYLGEGRRGHNAPRGAFTPGPGLVSGGA
FT                   VLGYGSAAGGRVPERWGDDGAVVYAQGADGPLIVAPDEAALREIAGQLSLPYSHRGPGD
FT                   PIAAVVPVLPGASPAGSGQTSSDWTDRTEYYWVFAMIAALILSVEAFLLIREVRQDQHG
FT                   GLV"
     MSAALVAAAA AIVLALRVYT LYCLLVRKSG GRLTAVLLRW GALTLAILCV FVAALRPSTS        60
     QRRQEPLTSP PVAAPSDNPE RNIFLLVDRS PNSWADDFGP KHDYRMAGVR ADLKAIVRQF       120
     PHANFSVIAF SATARVDWPL SADTWGLEAF LENYSAYPVT AGALDRADPT AASPLLNQGL       180
     DTARQQHPRS QNLVFYLGEG RRGHNAPRGA FTPGPGLVSG GAVLGYGSAA GGRVPERWGD       240
     DGAVVYAQGA DGPLIVAPDE AALREIAGQL SLPYSHRGPG DPIAAVVPVL PGASPAGSGQ       300
     TSSDWTDRTE YYWVFAMIAA LILSVEAFLL IREVRQDQHG GLV                         343
//

If you have problems or comments...

PBIL Back to PBIL home page