(data stored in ACNUC7421 zone)

EMBL: CP001958.PE227

CP001958.PE227       Location/Qualifiers
FT   CDS             complement(209350..210402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96720"
FT                   /db_xref="GOA:D6ZAH8"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH8"
FT                   /inference="similar to AA sequence:KEGG:MAB_0652"
FT                   /protein_id="ADG96720.1"
FT                   /translation="MFDSSFGQFSEPMPEPAPRRNRRALMVALASAGAIVLIVAIVWAV
FT                   SVFVVGPDAEKVAQTGGKTPEEAVRMYFDALAQDNPQKALALGVEQPSGAEFLTADVLK
FT                   RQQDLARISNTQILGSAAGSQPDTANVSVSVLFGDVKSEDVLTVRKTRAGWKLPHATIA
FT                   LRPSAPTGGGRALDFLTLFGKPAGNTKTIAVFPGALEVGSLNKNITLTAERDKELLGQL
FT                   YQGADPNWLVNGQLSQNGHDAVIQALDDKLQACEQSAELAPAGCPNKLNNDQAAPDTVH
FT                   WTETENYDDQDPAVTVDFATMTAKVTVTLHWNFTVELVGGGKGNGQFPAEPRDFTGSAD
FT                   LTRNQLEVVF"
     MFDSSFGQFS EPMPEPAPRR NRRALMVALA SAGAIVLIVA IVWAVSVFVV GPDAEKVAQT        60
     GGKTPEEAVR MYFDALAQDN PQKALALGVE QPSGAEFLTA DVLKRQQDLA RISNTQILGS       120
     AAGSQPDTAN VSVSVLFGDV KSEDVLTVRK TRAGWKLPHA TIALRPSAPT GGGRALDFLT       180
     LFGKPAGNTK TIAVFPGALE VGSLNKNITL TAERDKELLG QLYQGADPNW LVNGQLSQNG       240
     HDAVIQALDD KLQACEQSAE LAPAGCPNKL NNDQAAPDTV HWTETENYDD QDPAVTVDFA       300
     TMTAKVTVTL HWNFTVELVG GGKGNGQFPA EPRDFTGSAD LTRNQLEVVF                  350
//

If you have problems or comments...

PBIL Back to PBIL home page