(data stored in ACNUC7421 zone)

EMBL: CP001958.PE228

CP001958.PE228       Location/Qualifiers
FT   CDS             210517..211674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0234"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: nfa:nfa3680 DNA polymerase
FT                   III subunit delta'"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96721"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH9"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADG96721.1"
FT                   /translation="MGVYDYVLAADRVVAELRAAALAGRAEGKGFAQSWLFVGPPGSGR
FT                   SVAALSFAAALQCQAPEPGCGECRTCRSVFAGSHPDVRRLNPQGLSISVAEIREATGWT
FT                   ARLPASPWRILLVEDADRLTESATNALLKAVEEPSSRAVFLLCAPSVDPHDIAVTLRSR
FT                   CRLVSLGAPSREQVAKVLVERDGVDASTAQWAASVSAGHVGRARRLARDEAARDRRAAT
FT                   LALPLAMLDVRQRYDAAVRIASQASEEAAARCAALDAQELADLKEQLGVDGPGKAARAA
FT                   QGAVKELERKQKLRATRVERDALDGVLVDLLAYYRDALAWRWGAPTPALCPDVAEQVRE
FT                   LAERRDERRLLAAMEAILGAREAIAANVKPKVALTAMVSSLAMTS"
     MGVYDYVLAA DRVVAELRAA ALAGRAEGKG FAQSWLFVGP PGSGRSVAAL SFAAALQCQA        60
     PEPGCGECRT CRSVFAGSHP DVRRLNPQGL SISVAEIREA TGWTARLPAS PWRILLVEDA       120
     DRLTESATNA LLKAVEEPSS RAVFLLCAPS VDPHDIAVTL RSRCRLVSLG APSREQVAKV       180
     LVERDGVDAS TAQWAASVSA GHVGRARRLA RDEAARDRRA ATLALPLAML DVRQRYDAAV       240
     RIASQASEEA AARCAALDAQ ELADLKEQLG VDGPGKAARA AQGAVKELER KQKLRATRVE       300
     RDALDGVLVD LLAYYRDALA WRWGAPTPAL CPDVAEQVRE LAERRDERRL LAAMEAILGA       360
     REAIAANVKP KVALTAMVSS LAMTS                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page