(data stored in ACNUC7421 zone)

EMBL: CP001958.PE23

CP001958.PE23        Location/Qualifiers
FT   CDS             complement(24905..25657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_49090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96516"
FT                   /db_xref="GOA:D6Z9I9"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I9"
FT                   /inference="similar to AA sequence:KEGG:ROP_49090"
FT                   /protein_id="ADG96516.1"
FT                   /translation="MDTEPKDTAAEIVVSLSGIRDTTLGQARAFAELLDARGVPLSLLV
FT                   APKLPGKYKLAKDPGTADWLRERRAHGDAIVLHGYDQAATKRRKAEFAALPEYEARLRL
FT                   TAADRMMDHLGLRTRLFAPPEWAASPGAQAVLPALGFHQLVRADSVLEVRAGAARPARL
FT                   FAPRPKYESWQRRVVSFWAWRSGRRGELAQLAISGKHLETESVRGLFFEALGLALERGV
FT                   RPVRYTDLLGVSTTGGGPRFAALVTDVA"
     MDTEPKDTAA EIVVSLSGIR DTTLGQARAF AELLDARGVP LSLLVAPKLP GKYKLAKDPG        60
     TADWLRERRA HGDAIVLHGY DQAATKRRKA EFAALPEYEA RLRLTAADRM MDHLGLRTRL       120
     FAPPEWAASP GAQAVLPALG FHQLVRADSV LEVRAGAARP ARLFAPRPKY ESWQRRVVSF       180
     WAWRSGRRGE LAQLAISGKH LETESVRGLF FEALGLALER GVRPVRYTDL LGVSTTGGGP       240
     RFAALVTDVA                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page