(data stored in ACNUC7421 zone)

EMBL: CP001958.PE230

CP001958.PE230       Location/Qualifiers
FT   CDS             complement(212599..213102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0236"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: ami:Amir_0411 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96723"
FT                   /db_xref="GOA:D6ZAI1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG96723.1"
FT                   /translation="MGTGQPSGLAPEAKAPFHVGCYGDAADVFYLLLRILRGMRRAGDM
FT                   SSLTVSGISALFVIAQHGPLRLGDLANRERVTAPTMSRVVTLLEQAELVQREPDPADGR
FT                   ATLLSLTPQGSEYVAGDASEKIKTVESALATLSDEEQKQVVRWLQTLEAAVAKSSPEVD
FT                   DDLC"
     MGTGQPSGLA PEAKAPFHVG CYGDAADVFY LLLRILRGMR RAGDMSSLTV SGISALFVIA        60
     QHGPLRLGDL ANRERVTAPT MSRVVTLLEQ AELVQREPDP ADGRATLLSL TPQGSEYVAG       120
     DASEKIKTVE SALATLSDEE QKQVVRWLQT LEAAVAKSSP EVDDDLC                     167
//

If you have problems or comments...

PBIL Back to PBIL home page