(data stored in ACNUC7421 zone)

EMBL: CP001958.PE231

CP001958.PE231       Location/Qualifiers
FT   CDS             213235..214026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100021664"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96724"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96724.1"
FT                   /translation="MGPVRARRFFSTLAIAPDAVRVVNAVAYGAALGFRLAYVKSMVAN
FT                   PSKARTAAMRRAGAVTAAVEGGLYDAAHARLGDSFLAAQETYRRKRSILGDLLASEPAP
FT                   KRTALLSRALSGSRAVPGLRRLLPKPQPAQERRNRAKLVTPRCARALRSSVLGPSPTML
FT                   SADGEPHDYRTLWTPKDRRVEHQLLIALEEFSGLALPGLTKGNLLPFTDPETGLLVPWD
FT                   EAVASSGAIVVDRAVLEYLLDSRYGDGILRGAEAFNSARAL"
     MGPVRARRFF STLAIAPDAV RVVNAVAYGA ALGFRLAYVK SMVANPSKAR TAAMRRAGAV        60
     TAAVEGGLYD AAHARLGDSF LAAQETYRRK RSILGDLLAS EPAPKRTALL SRALSGSRAV       120
     PGLRRLLPKP QPAQERRNRA KLVTPRCARA LRSSVLGPSP TMLSADGEPH DYRTLWTPKD       180
     RRVEHQLLIA LEEFSGLALP GLTKGNLLPF TDPETGLLVP WDEAVASSGA IVVDRAVLEY       240
     LLDSRYGDGI LRGAEAFNSA RAL                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page