(data stored in ACNUC7421 zone)

EMBL: CP001958.PE233

CP001958.PE233       Location/Qualifiers
FT   CDS             complement(214213..215100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0239"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole-
FT                   succinocarboxamide synthase; KEGG: rha:RHA1_ro04817
FT                   phosphoribosylaminoimidazole- succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96726"
FT                   /db_xref="GOA:D6ZAI4"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI4"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADG96726.1"
FT                   /translation="MRPTLAEYPHVHSGKVRDLYAVDDEHLLFVASDRVSAYDHVLSTP
FT                   IPDKGRVLTALSVYFFDTLSAANHLAGPPDDERIPHEVLGRALVVRRLRMVPVECVVRG
FT                   FLTGSGWAEYQQEGSVSGVALPPGLRENARLEPPIFTPTTKAELGEHDESISLEKVAEQ
FT                   VGTDLAHRLRDAALGIFRSAARHVADRGLTLVDTKFEFGLDPQGQLVLADEALTPDSSR
FT                   YWPAESPGTSLDKQFVRNWLTSPESGWSKSGGTAPPALPDDVVAATRARYVQLYEQVTG
FT                   LSFAAWLSLGPASP"
     MRPTLAEYPH VHSGKVRDLY AVDDEHLLFV ASDRVSAYDH VLSTPIPDKG RVLTALSVYF        60
     FDTLSAANHL AGPPDDERIP HEVLGRALVV RRLRMVPVEC VVRGFLTGSG WAEYQQEGSV       120
     SGVALPPGLR ENARLEPPIF TPTTKAELGE HDESISLEKV AEQVGTDLAH RLRDAALGIF       180
     RSAARHVADR GLTLVDTKFE FGLDPQGQLV LADEALTPDS SRYWPAESPG TSLDKQFVRN       240
     WLTSPESGWS KSGGTAPPAL PDDVVAATRA RYVQLYEQVT GLSFAAWLSL GPASP            295
//

If you have problems or comments...

PBIL Back to PBIL home page