(data stored in ACNUC7421 zone)

EMBL: CP001958.PE234

CP001958.PE234       Location/Qualifiers
FT   CDS             215206..216189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0240"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: nfa:pnf1570 putative cation transporter;
FT                   TIGRFAM: cation diffusion facilitator family transporter;
FT                   PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96727"
FT                   /db_xref="GOA:D6ZAI5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI5"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADG96727.1"
FT                   /translation="MAHDHDHAHGVGESSDRTWLFAALCLLLLLMAAEAAAGLLSGSLA
FT                   LLSDAAHMLTDVASLGLAIMAVKLAARPARGAMTYGLRRVEILSAQINGATLLILGGWF
FT                   AYEGVQRLLRPHQVEGKLVLVTALVGVVVNLAATMCVNKANRASLNIEGAFQHILADLY
FT                   AFIATVVAGLVIWLTGFSRADALAALVVAGLMLTSGWTLVRAASRVLLEAAPNGFSPDA
FT                   IGAELAALPGVVEAHDLHIWEISSGHPALSVHVLVDEDADCHERRVAIKQLLWEEHGVE
FT                   HTTIQVDHFAAGEEHCHEPHGLVHRSGRDEIRVIEHTGTHGHHCRG"
     MAHDHDHAHG VGESSDRTWL FAALCLLLLL MAAEAAAGLL SGSLALLSDA AHMLTDVASL        60
     GLAIMAVKLA ARPARGAMTY GLRRVEILSA QINGATLLIL GGWFAYEGVQ RLLRPHQVEG       120
     KLVLVTALVG VVVNLAATMC VNKANRASLN IEGAFQHILA DLYAFIATVV AGLVIWLTGF       180
     SRADALAALV VAGLMLTSGW TLVRAASRVL LEAAPNGFSP DAIGAELAAL PGVVEAHDLH       240
     IWEISSGHPA LSVHVLVDED ADCHERRVAI KQLLWEEHGV EHTTIQVDHF AAGEEHCHEP       300
     HGLVHRSGRD EIRVIEHTGT HGHHCRG                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page