(data stored in ACNUC7421 zone)

EMBL: CP001958.PE235

CP001958.PE235       Location/Qualifiers
FT   CDS             216167..217330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0241"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rme:Rmet_5086 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96728"
FT                   /db_xref="GOA:D6ZAI6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI6"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADG96728.1"
FT                   /translation="MGITVEADFLVVGAGIAGASTGYFLAQHGKVVVLEREAAPGQHAT
FT                   GRSAAMYEPAYGNAQVRALTAASRSFFDSPPEGFAEHPLLSPRGVVIAQLAGEEFGPGA
FT                   DPAGPALTDEALIADLLEVPGATLLSKHDVLSLIPVLREEMVLGGVHDAQAEDVDVGEL
FT                   HLGFLKGIRARGGEVRCGRGVAAVSRVGAAWQVQAGDESYRAPVLVNAAGAWADVVARL
FT                   AGVREIGLVPKRRSAFVFHPPHGLDVRALPMFKDLRIGFYVKPDAGMLLGSPANADPTH
FT                   PQDVRPPDLDVALAIHRIEEATTLTVGRPLRAWAGLRSFVRDGGLVGGYAPDAAGFFWV
FT                   AAQGGYGIQTSPAMGEATAALALGEQIPEHIAAHSLTAEALAPDRLR"
     MGITVEADFL VVGAGIAGAS TGYFLAQHGK VVVLEREAAP GQHATGRSAA MYEPAYGNAQ        60
     VRALTAASRS FFDSPPEGFA EHPLLSPRGV VIAQLAGEEF GPGADPAGPA LTDEALIADL       120
     LEVPGATLLS KHDVLSLIPV LREEMVLGGV HDAQAEDVDV GELHLGFLKG IRARGGEVRC       180
     GRGVAAVSRV GAAWQVQAGD ESYRAPVLVN AAGAWADVVA RLAGVREIGL VPKRRSAFVF       240
     HPPHGLDVRA LPMFKDLRIG FYVKPDAGML LGSPANADPT HPQDVRPPDL DVALAIHRIE       300
     EATTLTVGRP LRAWAGLRSF VRDGGLVGGY APDAAGFFWV AAQGGYGIQT SPAMGEATAA       360
     LALGEQIPEH IAAHSLTAEA LAPDRLR                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page