(data stored in ACNUC7421 zone)

EMBL: CP001958.PE238

CP001958.PE238       Location/Qualifiers
FT   CDS             218317..221145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0244"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="KEGG: nfa:nfa55240 leucyl-tRNA synthetase; TIGRFAM:
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96731"
FT                   /db_xref="GOA:D6ZAI9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI9"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ADG96731.1"
FT                   /translation="MTEPAAHRYDNATVRRIEEFWQAEWQRSGALHADNPTGELAGDGA
FT                   AREPFFIMDMFPYPSGDGLHVGHPLGFIATDVFARFQRMAGKNVLHTMGFDSFGLPTEI
FT                   YAVQTGTHPAAVTDRNVERFLRQIRRIGLGHDERRRFKTSDPDYYRWTQWIFLKIYNAW
FT                   YDREAGRARPVGELEAAFASGARATPDGRAWSALTKAEQRAVVDSHRLVGRHESVVNWC
FT                   PGLGTVLSNEEVTDEGRSERGNFPVFRKSLRQWTMRITEYADRLIDDLDRLDWPEKVKS
FT                   MQRNWIGRSTGAVVSFPCGEQVLEVFTTRPDTLYGVTFLVAAPESELVASLVPQAWPVG
FT                   TDPRWTGSAATPAEAVATYRAKVANRAERERQEDKAKTGVFTGAFAVNPLTQERIPVFV
FT                   ADYVLAGYGTGVVMAVPGHDQRDWDFAKTFGLPVAEVVSGGDVEIGAHTGEGQLVNSGS
FT                   WDGLSASEAKAVAADDLERLGVGRKQLQYKLRDWLFARQRYWGEPFPLVADESGQVFPL
FT                   DDTALPVLLPQIEDFRPIVFDADDQDSRPSAPLKKAGDWLTVECDFGDGAQPYTRETDV
FT                   MPNWAGSCWYYLRYLDPKNEEAFCDPENERYWIGPRPDARGGADPGGVDLYVGGTEHAV
FT                   LHLLYARFWHKVLHDLGYVSSAEPFRRLFNQGYIQAPSYTDSRGAYVPAAEVEERDGEF
FT                   FWQGQPVKREFGKMGKSLKNSITPDEICDEYGADTLRVYEMSMGPLDQSKDWSTKDIVG
FT                   AQRFLARVWRVVVDEQSGQACVVDAEPDAETVRALHRAIDQVGQEYAALKFNLAVAKLI
FT                   EYTNYLTKRYLSGQQGAEGAPRAAVEPLVVMLAPLAPHLAEELWRRLGHDELLVRHPFP
FT                   TADPAFLVDDEVKLPVQVAGKVRATIVVPAGVSEDVVRAAALADPKVVEHLAGKEPKRV
FT                   IVVPKKMVSIVL"
     MTEPAAHRYD NATVRRIEEF WQAEWQRSGA LHADNPTGEL AGDGAAREPF FIMDMFPYPS        60
     GDGLHVGHPL GFIATDVFAR FQRMAGKNVL HTMGFDSFGL PTEIYAVQTG THPAAVTDRN       120
     VERFLRQIRR IGLGHDERRR FKTSDPDYYR WTQWIFLKIY NAWYDREAGR ARPVGELEAA       180
     FASGARATPD GRAWSALTKA EQRAVVDSHR LVGRHESVVN WCPGLGTVLS NEEVTDEGRS       240
     ERGNFPVFRK SLRQWTMRIT EYADRLIDDL DRLDWPEKVK SMQRNWIGRS TGAVVSFPCG       300
     EQVLEVFTTR PDTLYGVTFL VAAPESELVA SLVPQAWPVG TDPRWTGSAA TPAEAVATYR       360
     AKVANRAERE RQEDKAKTGV FTGAFAVNPL TQERIPVFVA DYVLAGYGTG VVMAVPGHDQ       420
     RDWDFAKTFG LPVAEVVSGG DVEIGAHTGE GQLVNSGSWD GLSASEAKAV AADDLERLGV       480
     GRKQLQYKLR DWLFARQRYW GEPFPLVADE SGQVFPLDDT ALPVLLPQIE DFRPIVFDAD       540
     DQDSRPSAPL KKAGDWLTVE CDFGDGAQPY TRETDVMPNW AGSCWYYLRY LDPKNEEAFC       600
     DPENERYWIG PRPDARGGAD PGGVDLYVGG TEHAVLHLLY ARFWHKVLHD LGYVSSAEPF       660
     RRLFNQGYIQ APSYTDSRGA YVPAAEVEER DGEFFWQGQP VKREFGKMGK SLKNSITPDE       720
     ICDEYGADTL RVYEMSMGPL DQSKDWSTKD IVGAQRFLAR VWRVVVDEQS GQACVVDAEP       780
     DAETVRALHR AIDQVGQEYA ALKFNLAVAK LIEYTNYLTK RYLSGQQGAE GAPRAAVEPL       840
     VVMLAPLAPH LAEELWRRLG HDELLVRHPF PTADPAFLVD DEVKLPVQVA GKVRATIVVP       900
     AGVSEDVVRA AALADPKVVE HLAGKEPKRV IVVPKKMVSI VL                          942
//

If you have problems or comments...

PBIL Back to PBIL home page