(data stored in ACNUC7421 zone)

EMBL: CP001958.PE24

CP001958.PE24        Location/Qualifiers
FT   CDS             complement(25876..26169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0024"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: nfa:nfa14720 putative DNA-binding protein;
FT                   PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96517"
FT                   /db_xref="GOA:D6Z9J0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J0"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADG96517.1"
FT                   /translation="MLAIYDSGTSPEISLKYRLLIARMEAGLEQSQLAERTGISVRTIR
FT                   NAERGHTSPKQHVIYQWALATGVPATWLLTGQDPNKNGGPDGPSAGTYGSSD"
     MLAIYDSGTS PEISLKYRLL IARMEAGLEQ SQLAERTGIS VRTIRNAERG HTSPKQHVIY        60
     QWALATGVPA TWLLTGQDPN KNGGPDGPSA GTYGSSD                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page