(data stored in ACNUC7421 zone)

EMBL: CP001958.PE241

CP001958.PE241       Location/Qualifiers
FT   CDS             223573..224223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0247"
FT                   /product="DNA repair protein RadC"
FT                   /note="KEGG: nfa:nfa9430 putative DNA repair protein;
FT                   TIGRFAM: DNA repair protein RadC; PFAM: DNA repair protein
FT                   RadC; helix-hairpin-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96734"
FT                   /db_xref="GOA:D6ZAJ2"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAJ2"
FT                   /inference="protein motif:TFAM:TIGR00608"
FT                   /protein_id="ADG96734.1"
FT                   /translation="MRDIPQHDRPRERLLRQGAAALSEAELVAIHLGSGHARASALDVA
FT                   HVLLTSWGGVHGLARARPEELARTPGVGPAKAARLAAAFAIAGRVDAPDEPVQLVQSSD
FT                   IARVASRVLGASRTEQVAVLVADARLRLRRTEIVAMGSATACPVPVREILATVLRHDGV
FT                   AFALAHNHPSGDPTPSAADRALTDMLHNAAWATGLRFLDHIVVAGERWRSAAF"
     MRDIPQHDRP RERLLRQGAA ALSEAELVAI HLGSGHARAS ALDVAHVLLT SWGGVHGLAR        60
     ARPEELARTP GVGPAKAARL AAAFAIAGRV DAPDEPVQLV QSSDIARVAS RVLGASRTEQ       120
     VAVLVADARL RLRRTEIVAM GSATACPVPV REILATVLRH DGVAFALAHN HPSGDPTPSA       180
     ADRALTDMLH NAAWATGLRF LDHIVVAGER WRSAAF                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page