(data stored in ACNUC7421 zone)

EMBL: CP001958.PE242

CP001958.PE242       Location/Qualifiers
FT   CDS             complement(224227..224871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_4399c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96735"
FT                   /db_xref="GOA:D6ZAJ3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAJ3"
FT                   /inference="similar to AA sequence:KEGG:MAB_4399c"
FT                   /protein_id="ADG96735.1"
FT                   /translation="MPGIPQESARSSAIVRKTLLAALTPLIVYYLARACGAPPWLALTA
FT                   SVVAAAAQTAVNALRERKLDLVSGYMLLLFGMNLAVVLLTENPRLAMAINSVPAFVLAL
FT                   FLLVSGIIRKPVTQDLVEKLRPSLRESELPGRGWSAQDIRDYRAAHARLSVLSGAACLA
FT                   LSLIGLAFIISLPVDMSQLLNSIVSNAGAVLVVILIVSKVRSFVKSHDRPA"
     MPGIPQESAR SSAIVRKTLL AALTPLIVYY LARACGAPPW LALTASVVAA AAQTAVNALR        60
     ERKLDLVSGY MLLLFGMNLA VVLLTENPRL AMAINSVPAF VLALFLLVSG IIRKPVTQDL       120
     VEKLRPSLRE SELPGRGWSA QDIRDYRAAH ARLSVLSGAA CLALSLIGLA FIISLPVDMS       180
     QLLNSIVSNA GAVLVVILIV SKVRSFVKSH DRPA                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page