(data stored in ACNUC7421 zone)

EMBL: CP001958.PE246

CP001958.PE246       Location/Qualifiers
FT   CDS             228388..229284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0252"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96739"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96739.1"
FT                   /translation="MTQPHEKLPPARNPKPLEERIRILDEELPQLRVSGESACRRVFAT
FT                   VGHERALLELRLAWEALADEFELARGSRNEPLGHVALARIIETAVHAALAGYSQAVVDA
FT                   MHEPKPAGASLENQFYDEYWDLPEDERPDSVDDYIRQRKAELGGPVQPEDQYQADEAAA
FT                   QERIRAEVGSLADLDPDKLRVTESWMTDEAAELRERYAETVRKLQAFDPAGVRGVGKDN
FT                   PHNPIVKVTVSMASAFELELGERVWSDPGSRLGQAVVKAHAAARADFAAKMHDGGITLW
FT                   GDGRPDEEQPGGAPSRA"
     MTQPHEKLPP ARNPKPLEER IRILDEELPQ LRVSGESACR RVFATVGHER ALLELRLAWE        60
     ALADEFELAR GSRNEPLGHV ALARIIETAV HAALAGYSQA VVDAMHEPKP AGASLENQFY       120
     DEYWDLPEDE RPDSVDDYIR QRKAELGGPV QPEDQYQADE AAAQERIRAE VGSLADLDPD       180
     KLRVTESWMT DEAAELRERY AETVRKLQAF DPAGVRGVGK DNPHNPIVKV TVSMASAFEL       240
     ELGERVWSDP GSRLGQAVVK AHAAARADFA AKMHDGGITL WGDGRPDEEQ PGGAPSRA         298
//

If you have problems or comments...

PBIL Back to PBIL home page