(data stored in ACNUC7421 zone)

EMBL: CP001958.PE247

CP001958.PE247       Location/Qualifiers
FT   CDS             229395..229871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS05355 putative methyl-accepting
FT                   chemotaxis transducer transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96740"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96740.1"
FT                   /translation="MNAVNPGNPGLKLTDIGGGASGRTNIDLDALGRVTLKMEPLRAEL
FT                   DGLIKQWDESTERYHAAAGSDDMNGNLKQQSTQAKQDADQHSKATSERAQKAADTSKEA
FT                   HAQYSGVEDDNHTELKKPGDHLSGGGGANFNAPAATQAGADSNASAATGGPVAR"
     MNAVNPGNPG LKLTDIGGGA SGRTNIDLDA LGRVTLKMEP LRAELDGLIK QWDESTERYH        60
     AAAGSDDMNG NLKQQSTQAK QDADQHSKAT SERAQKAADT SKEAHAQYSG VEDDNHTELK       120
     KPGDHLSGGG GANFNAPAAT QAGADSNASA ATGGPVAR                               158
//

If you have problems or comments...

PBIL Back to PBIL home page