(data stored in ACNUC7421 zone)

EMBL: CP001958.PE248

CP001958.PE248       Location/Qualifiers
FT   CDS             231468..232169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_09190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96741"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96741.1"
FT                   /translation="MFFKSAGGISAGEVLGRSRRVLTWGVYWRGSLWRMQFWLVGMQSS
FT                   PQKVRDEELGMKVVSRAAVLGLAGLVAFGAAGCNRGGSGGGTTTIIQQAPPINGGSAQS
FT                   NSLTPSVTQTPISDSKKLCSLAQGRGLEIVHAIDKFWGLVMKDGWSWGDEKVASAADNA
FT                   GQVVSKVAPVLEAAIGSGAPKDIADAIQKFVKSSRSFADAITNRADGDTMNPLNKDFGA
FT                   AVDNLKAVCSI"
     MFFKSAGGIS AGEVLGRSRR VLTWGVYWRG SLWRMQFWLV GMQSSPQKVR DEELGMKVVS        60
     RAAVLGLAGL VAFGAAGCNR GGSGGGTTTI IQQAPPINGG SAQSNSLTPS VTQTPISDSK       120
     KLCSLAQGRG LEIVHAIDKF WGLVMKDGWS WGDEKVASAA DNAGQVVSKV APVLEAAIGS       180
     GAPKDIADAI QKFVKSSRSF ADAITNRADG DTMNPLNKDF GAAVDNLKAV CSI              233
//

If you have problems or comments...

PBIL Back to PBIL home page